A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10235
Swiss-prot Accession number	Q6S9C5 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta-4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Chinchilla lanigera (Long-tailed chinchilla) (Chinchilla villidera)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla.
Subcellular location	Cytoplasm (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Erdos G., Hu F.Z., Donfack J., Ahmed A.I., Preston R.A., Hayes J.D.,Post J.C., Ehrlich G.D.; "The thymosin beta-4 gene is expressed in chinchilla middle earmucosa."; Submitted (NOV-2003) to the EMBL/GenBank/DDBJ databases.
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	11056
Swiss-prot Accession number	Q6S9C5 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta-4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Chinchilla lanigera (Long-tailed chinchilla) (Chinchilla villidera)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla.
Subcellular location	Cytoplasm (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Erdos G., Hu F.Z., Donfack J., Ahmed A.I., Preston R.A., Hayes J.D.,Post J.C., Ehrlich G.D.; "The thymosin beta-4 gene is expressed in chinchilla middle earmucosa."; Submitted (NOV-2003) to the EMBL/GenBank/DDBJ databases.
Domain Name	Thymosin
Hormone Name	Hematopoietic system regulatory peptide
Mature Hormone Sequence	SDKP
Position of mature hormone in Pre-Hormone protein	4 Residues from position (2-5)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated